Lineage for d1elo_4 (1elo 600-689)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) 
Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein) Protein Elongation factor G (EF-G), domains III and V [54982] (1 species) Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries) 
Domain d1elo_4: 1elo 600-689 [39304]
Other proteins in same PDB: d1elo_1, d1elo_2, d1elo_3
Details for d1elo_4
PDB Entry: 1elo (more details), 2.85 Å
PDB Description: elongation factor g without nucleotide
SCOP Domain Sequences for d1elo_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elo_4 d.58.11.1 (600-689) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik
SCOP Domain Coordinates for d1elo_4:
Click to download the PDB-style file with coordinates for d1elo_4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1elo_4:
- d1elo_4 first appeared (with stable ids) in SCOP 1.55
- d1elo_4 appears in SCOP 1.59
- d1elo_4 appears in the current release, SCOPe 2.08, called d1eloa4
View in 3D
