Lineage for d1fnma4 (1fnm A:404-482)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560339Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2560340Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2560396Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2560397Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 2560404Domain d1fnma4: 1fnm A:404-482 [39302]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3
    complexed with gdp, mg

Details for d1fnma4

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1fnma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma4 d.58.11.1 (A:404-482) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgkpqva

SCOPe Domain Coordinates for d1fnma4:

Click to download the PDB-style file with coordinates for d1fnma4.
(The format of our PDB-style files is described here.)

Timeline for d1fnma4: