Lineage for d1fnma4 (1fnm A:404-482)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192533Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) (S)
  5. 192534Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)
  6. 192535Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)
  7. 192536Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 192539Domain d1fnma4: 1fnm A:404-482 [39302]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3

Details for d1fnma4

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma4 d.58.11.1 (A:404-482) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgkpqva

SCOP Domain Coordinates for d1fnma4:

Click to download the PDB-style file with coordinates for d1fnma4.
(The format of our PDB-style files is described here.)

Timeline for d1fnma4: