Lineage for d1fnma4 (1fnm A:404-482)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133849Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) (S)
  5. 133850Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)
  6. 133851Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)
  7. 133852Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 133855Domain d1fnma4: 1fnm A:404-482 [39302]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3

Details for d1fnma4

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma4 d.58.11.1 (A:404-482) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgkpqva

SCOP Domain Coordinates for d1fnma4:

Click to download the PDB-style file with coordinates for d1fnma4.
(The format of our PDB-style files is described here.)

Timeline for d1fnma4: