SCOP 1.57: Domain d1fnma4: 1fnm A:404-482

Lineage for d1fnma4 (1fnm A:404-482)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family)

5. Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)

6. Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)

8. Domain d1fnma4: 1fnm A:404-482 [39302]
   Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3

Details for d1fnma4

PDB Entry: 1fnm, 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma4:

Sequence; same for both SEQRES and ATOM records:

>d1fnma4 d.58.11.1 (A:404-482) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgkpqva

Timeline for d1fnma4:

• d1fnma4 first appeared (with stable ids) in SCOP 1.55
  
• d1fnma4 appears in SCOP 1.59
  
• d1fnma4 appears in the current release, SCOPe 2.08