SCOPe 2.05: Domain d2efga4: 2efg A:600-689

Lineage for d2efga4 (2efg A:600-689)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)

8. Domain d2efga4: 2efg A:600-689 [39301]
   Other proteins in same PDB: d2efga1, d2efga2, d2efga3
   complexed with gdp

Details for d2efga4

PDB Entry: 2efg, 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

PDB Compounds: (A:) protein (elongation factor g)

SCOPe Domain Sequences for d2efga4:

Sequence; same for both SEQRES and ATOM records:

>d2efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

Timeline for d2efga4:

• d2efga4 first appeared (with stable ids) in SCOP 1.55
  
• d2efga4 appears in SCOPe 2.04
  
• d2efga4 appears in SCOPe 2.06
  
• d2efga4 appears in the current release, SCOPe 2.08