Lineage for d2efga4 (2efg A:600-689)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604341Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 604342Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 604353Protein Elongation factor G (EF-G) [54982] (1 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 604354Species Thermus thermophilus [TaxId:274] [54983] (6 PDB entries)
  8. 604356Domain d2efga4: 2efg A:600-689 [39301]
    Other proteins in same PDB: d2efga1, d2efga2, d2efga3
    complexed with gdp

Details for d2efga4

PDB Entry: 2efg (more details), 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

SCOP Domain Sequences for d2efga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOP Domain Coordinates for d2efga4:

Click to download the PDB-style file with coordinates for d2efga4.
(The format of our PDB-style files is described here.)

Timeline for d2efga4: