![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) ![]() |
![]() | Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein) |
![]() | Protein Elongation factor G (EF-G), domains III and V [54982] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries) |
![]() | Domain d2efga4: 2efg A:600-689 [39301] Other proteins in same PDB: d2efga1, d2efga2, d2efga3 |
PDB Entry: 2efg (more details), 2.6 Å
SCOP Domain Sequences for d2efga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G), domains III and V {Thermus thermophilus} vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl rsktqgrgsfvmffdhyqevpkqvqeklik
Timeline for d2efga4: