Lineage for d1dar_4 (1dar 600-689)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133849Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) (S)
  5. 133850Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)
  6. 133851Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)
  7. 133852Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 133853Domain d1dar_4: 1dar 600-689 [39300]
    Other proteins in same PDB: d1dar_1, d1dar_2, d1dar_3

Details for d1dar_4

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp

SCOP Domain Sequences for d1dar_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dar_4 d.58.11.1 (600-689) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOP Domain Coordinates for d1dar_4:

Click to download the PDB-style file with coordinates for d1dar_4.
(The format of our PDB-style files is described here.)

Timeline for d1dar_4: