![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein automated matches [339417] (5 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [392996] (1 PDB entry) |
![]() | Domain d6wj6k_: 6wj6 K: [392997] Other proteins in same PDB: d6wj6a_, d6wj6b_, d6wj6c_, d6wj6d_, d6wj6e_, d6wj6f_, d6wj6h_, d6wj6m_ automated match to d5h2fk_ complexed with bcr, bct, cl, cla, dgd, fe2, fme, hem, lhg, lmg, lmt, pho, pl9, sqd |
PDB Entry: 6wj6 (more details), 2.58 Å
SCOPe Domain Sequences for d6wj6k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wj6k_ f.23.36.1 (K:) automated matches {Synechocystis sp. [TaxId: 1111708]} klpeayqifdplvdvlpviplfflalafvwqaavg
Timeline for d6wj6k_: