Lineage for d6wj6k_ (6wj6 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026682Protein automated matches [339417] (5 species)
    not a true protein
  7. 3026687Species Synechocystis sp. [TaxId:1111708] [392996] (1 PDB entry)
  8. 3026688Domain d6wj6k_: 6wj6 K: [392997]
    Other proteins in same PDB: d6wj6a_, d6wj6b_, d6wj6c_, d6wj6d_, d6wj6e_, d6wj6f_, d6wj6h_, d6wj6m_
    automated match to d5h2fk_
    complexed with bcr, bct, cl, cla, dgd, fe2, fme, hem, lhg, lmg, lmt, pho, pl9, sqd

Details for d6wj6k_

PDB Entry: 6wj6 (more details), 2.58 Å

PDB Description: cryo-em structure of apo-photosystem ii from synechocystis sp. pcc 6803
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d6wj6k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wj6k_ f.23.36.1 (K:) automated matches {Synechocystis sp. [TaxId: 1111708]}
klpeayqifdplvdvlpviplfflalafvwqaavg

SCOPe Domain Coordinates for d6wj6k_:

Click to download the PDB-style file with coordinates for d6wj6k_.
(The format of our PDB-style files is described here.)

Timeline for d6wj6k_: