Lineage for d1rbab2 (1rba B:5-137)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205860Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1205861Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1205862Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1205992Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 1206002Domain d1rbab2: 1rba B:5-137 [39297]
    Other proteins in same PDB: d1rbaa1, d1rbab1

Details for d1rbab2

PDB Entry: 1rba (more details), 2.6 Å

PDB Description: substitution of asp193 to asn at the active site of ribulose-1,5- bisphosphate carboxylase results in conformational changes
PDB Compounds: (B:) rubisco

SCOPe Domain Sequences for d1rbab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbab2 d.58.9.1 (B:5-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
dfyvpeayralfd

SCOPe Domain Coordinates for d1rbab2:

Click to download the PDB-style file with coordinates for d1rbab2.
(The format of our PDB-style files is described here.)

Timeline for d1rbab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rbab1