Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries) Uniprot P15873 |
Domain d6w9wa2: 6w9w A:127-254 [392965] Other proteins in same PDB: d6w9wa3 automated match to d1plqa2 mutant |
PDB Entry: 6w9w (more details), 2.65 Å
SCOPe Domain Sequences for d6w9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9wa2 d.131.1.2 (A:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkf
Timeline for d6w9wa2: