SCOP 1.59: Domain d1rbaa2: 1rba A:5-137

Lineage for d1rbaa2 (1rba A:5-137)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d1rbaa2: 1rba A:5-137 [39296]
   Other proteins in same PDB: d1rbaa1, d1rbab1

Details for d1rbaa2

PDB Entry: 1rba, 2.6 Å

PDB Description: substitution of asp193 to asn at the active site of ribulose-1,5- bisphosphate carboxylase results in conformational changes

SCOP Domain Sequences for d1rbaa2:

Sequence, based on SEQRES records:

>d1rbaa2 d.58.9.1 (A:5-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
dfyvpeayralfd

Sequence, based on observed residues (ATOM records):

>d1rbaa2 d.58.9.1 (A:5-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvtrgvdalvy
evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
ralfd

Timeline for d1rbaa2:

• d1rbaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1rbaa2 appears in SCOP 1.57
  
• d1rbaa2 appears in SCOP 1.61
  
• d1rbaa2 appears in the current release, SCOPe 2.08