Lineage for d1rusb2 (1rus B:3-137)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133756Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 133757Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 133758Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 133780Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 133788Domain d1rusb2: 1rus B:3-137 [39295]
    Other proteins in same PDB: d1rusa1, d1rusb1

Details for d1rusb2

PDB Entry: 1rus (more details), 2.9 Å

PDB Description: crystal structure of the binary complex of ribulose-1,5-bisphosphate carboxylase and its product, 3-phospho-d-glycerate

SCOP Domain Sequences for d1rusb2:

Sequence, based on SEQRES records: (download)

>d1rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd

Sequence, based on observed residues (ATOM records): (download)

>d1rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtgvdalvyev
deareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeayra
lfd

SCOP Domain Coordinates for d1rusb2:

Click to download the PDB-style file with coordinates for d1rusb2.
(The format of our PDB-style files is described here.)

Timeline for d1rusb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rusb1