SCOPe 2.08: Domain d6w9uh1: 6w9u H:1-116

Lineage for d6w9uh1 (6w9u H:1-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6w9uh1: 6w9u H:1-116 [392943]
   Other proteins in same PDB: d6w9ua1, d6w9ua3, d6w9ub1, d6w9ub2, d6w9uc1, d6w9uc3, d6w9ud2, d6w9uf1, d6w9uf2, d6w9ug2
   automated match to d2axha1
   complexed with cl, gol, tkg

Details for d6w9uh1

PDB Entry: 6w9u, 1.89 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h-ac-6- fp

PDB Compounds: (H:) TCR-beta chain

SCOPe Domain Sequences for d6w9uh1:

Sequence; same for both SEQRES and ATOM records:

>d6w9uh1 b.1.1.0 (H:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgev
pngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d6w9uh1:

• d6w9uh1 first appeared in SCOPe 2.07