SCOPe 2.08: Domain d6w9ua1: 6w9u A:1-178

Lineage for d6w9ua1 (6w9u A:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6w9ua1: 6w9u A:1-178 [392938]
   Other proteins in same PDB: d6w9ua2, d6w9ua3, d6w9ub1, d6w9ub2, d6w9uc2, d6w9uc3, d6w9ud1, d6w9ud2, d6w9ue1, d6w9ue2, d6w9uf1, d6w9uf2, d6w9ug1, d6w9ug2, d6w9uh1, d6w9uh2
   automated match to d4l4va1
   complexed with cl, gol, tkg

Details for d6w9ua1

PDB Entry: 6w9u, 1.89 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h-ac-6- fp

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6w9ua1:

Sequence; same for both SEQRES and ATOM records:

>d6w9ua1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfhlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d6w9ua1:

• d6w9ua1 first appeared in SCOPe 2.07