SCOP 1.57: Domain d9ruba2: 9rub A:2-137

Lineage for d9ruba2 (9rub A:2-137)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d9ruba2: 9rub A:2-137 [39292]
   Other proteins in same PDB: d9ruba1, d9rubb1

Details for d9ruba2

PDB Entry: 9rub, 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

SCOP Domain Sequences for d9ruba2:

Sequence; same for both SEQRES and ATOM records:

>d9ruba2 d.58.9.1 (A:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Timeline for d9ruba2:

• d9ruba2 first appeared (with stable ids) in SCOP 1.55
  
• d9ruba2 appears in SCOP 1.59
  
• d9ruba2 appears in the current release, SCOPe 2.08