SCOP 1.73: Domain d2rusb2: 2rus B:3-137

Lineage for d2rusb2 (2rus B:3-137)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d2rusb2: 2rus B:3-137 [39291]
   Other proteins in same PDB: d2rusa1, d2rusb1
   complexed with for, mg

Details for d2rusb2

PDB Entry: 2rus, 2.3 Å

PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution

PDB Compounds: (B:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)

SCOP Domain Sequences for d2rusb2:

Sequence, based on SEQRES records:

>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd

Sequence, based on observed residues (ATOM records):

>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdalv
yevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpea
yralfd

Timeline for d2rusb2:

• d2rusb2 first appeared (with stable ids) in SCOP 1.55
  
• d2rusb2 appears in SCOP 1.71
  
• d2rusb2 appears in SCOP 1.75
  
• d2rusb2 appears in the current release, SCOPe 2.08