Lineage for d2rusb2 (2rus B:3-137)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192424Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 192425Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 192426Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 192464Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 192468Domain d2rusb2: 2rus B:3-137 [39291]
    Other proteins in same PDB: d2rusa1, d2rusb1

Details for d2rusb2

PDB Entry: 2rus (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution

SCOP Domain Sequences for d2rusb2:

Sequence, based on SEQRES records: (download)

>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd

Sequence, based on observed residues (ATOM records): (download)

>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdalv
yevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpea
yralfd

SCOP Domain Coordinates for d2rusb2:

Click to download the PDB-style file with coordinates for d2rusb2.
(The format of our PDB-style files is described here.)

Timeline for d2rusb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rusb1