Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6w9vb1: 6w9v B:1-97 [392903] Other proteins in same PDB: d6w9va1, d6w9va2, d6w9va3, d6w9vb2, d6w9vc1, d6w9vc2, d6w9vc3, d6w9vd1, d6w9vd2, d6w9ve1, d6w9ve2, d6w9vf2, d6w9vg1, d6w9vg2, d6w9vh1, d6w9vh2 automated match to d1duzb_ complexed with act, gol |
PDB Entry: 6w9v (more details), 1.95 Å
SCOPe Domain Sequences for d6w9vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9vb1 b.1.1.2 (B:1-97) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d6w9vb1: