SCOP 1.59: Domain d1rsca2: 1rsc A:9-147

Lineage for d1rsca2 (1rsc A:9-147)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)

8. Domain d1rsca2: 1rsc A:9-147 [39287]
   Other proteins in same PDB: d1rsca1, d1rscm_

Details for d1rsca2

PDB Entry: 1rsc, 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

SCOP Domain Sequences for d1rsca2:

Sequence; same for both SEQRES and ATOM records:

>d1rsca2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

Timeline for d1rsca2:

• d1rsca2 first appeared (with stable ids) in SCOP 1.55
  
• d1rsca2 appears in SCOP 1.57
  
• d1rsca2 appears in SCOP 1.61
  
• d1rsca2 appears in the current release, SCOPe 2.08