SCOP 1.61: Domain d1bxng2: 1bxn G:22-150

Lineage for d1bxng2 (1bxn G:22-150)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [54972] (1 PDB entry)

8. Domain d1bxng2: 1bxn G:22-150 [39285]
   Other proteins in same PDB: d1bxna1, d1bxnc1, d1bxne1, d1bxng1, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_

Details for d1bxng2

PDB Entry: 1bxn, 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

SCOP Domain Sequences for d1bxng2:

Sequence; same for both SEQRES and ATOM records:

>d1bxng2 d.58.9.1 (G:22-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
fpvayvkt

Timeline for d1bxng2:

• d1bxng2 first appeared (with stable ids) in SCOP 1.55
  
• d1bxng2 appears in SCOP 1.59
  
• d1bxng2 appears in SCOP 1.63
  
• d1bxng2 appears in the current release, SCOPe 2.08