SCOPe 2.07: Domain d6vsrb2: 6vsr B:107-213

Lineage for d6vsrb2 (6vsr B:107-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)

8. Domain d6vsrb2: 6vsr B:107-213 [392832]
   Other proteins in same PDB: d6vsrb1
   automated match to d1dn0a2
   complexed with so4

Details for d6vsrb2

PDB Entry: 6vsr, 2.18 Å

PDB Description: crystal structure of macaque anti-hiv-1 antibody rm20f

PDB Compounds: (B:) RM20F Fab Light Chain

SCOPe Domain Sequences for d6vsrb2:

Sequence; same for both SEQRES and ATOM records:

>d6vsrb2 b.1.1.2 (B:107-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6vsrb2:

• d6vsrb2 is new in SCOPe 2.07-stable
  
• d6vsrb2 appears in the current release, SCOPe 2.08