SCOPe 2.08: Domain d6vooa1: 6voo A:6-95

Lineage for d6vooa1 (6voo A:6-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [352451] (2 PDB entries)

8. Domain d6vooa1: 6voo A:6-95 [392800]
   Other proteins in same PDB: d6vooa2, d6vooa3, d6voob2, d6voob3, d6vooc2, d6vooc3, d6vood2, d6vood3, d6vooe2, d6vooe3, d6voof2, d6voof3
   automated match to d1maba2
   complexed with adp, atp, ttx

Details for d6vooa1

PDB Entry: 6voo, 3.05 Å

PDB Description: chloroplast atp synthase (r1, cf1)

PDB Compounds: (A:) ATP synthase subunit alpha, chloroplastic

SCOPe Domain Sequences for d6vooa1:

Sequence; same for both SEQRES and ATOM records:

>d6vooa1 b.49.1.0 (A:6-95) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
adeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigial
nlesnnvgvvlmgdglmiqegssvkatgri

Timeline for d6vooa1:

• d6vooa1 first appeared in SCOPe 2.07