Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [352451] (2 PDB entries) |
Domain d6vooa1: 6voo A:6-95 [392800] Other proteins in same PDB: d6vooa2, d6vooa3, d6voob2, d6voob3, d6vooc2, d6vooc3, d6vood2, d6vood3, d6vooe2, d6vooe3, d6voof2, d6voof3 automated match to d1maba2 complexed with adp, atp, ttx |
PDB Entry: 6voo (more details), 3.05 Å
SCOPe Domain Sequences for d6vooa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vooa1 b.49.1.0 (A:6-95) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} adeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigial nlesnnvgvvlmgdglmiqegssvkatgri
Timeline for d6vooa1: