SCOPe 2.07: Domain d6vord1: 6vor D:1-106

Lineage for d6vord1 (6vor D:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries)

8. Domain d6vord1: 6vor D:1-106 [392790]
   Other proteins in same PDB: d6vorb2, d6vord2
   automated match to d1dn0a1
   complexed with gly

Details for d6vord1

PDB Entry: 6vor, 1.85 Å

PDB Description: crystal structure of macaque anti-hiv-1 antibody rm20e1

PDB Compounds: (D:) RM20E1 Fab light chain

SCOPe Domain Sequences for d6vord1:

Sequence; same for both SEQRES and ATOM records:

>d6vord1 b.1.1.0 (D:1-106) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
dvvmtqsplslpitpgqpasiscrssqslvhnngntyltwyqqrpgqpprrliyqvsnrd
sgvpdrfigsgagtdftlkisrvesedvgiyycgqitdfpysfgqgtkvdi

Timeline for d6vord1:

• d6vord1 is new in SCOPe 2.07-stable
  
• d6vord1 appears in the current release, SCOPe 2.08