Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [352453] (2 PDB entries) |
Domain d6voob2: 6voo B:96-372 [392766] Other proteins in same PDB: d6vooa1, d6vooa3, d6voob1, d6voob3, d6vooc1, d6vooc3, d6vood1, d6vood2, d6vood3, d6vooe1, d6vooe2, d6vooe3, d6voof1, d6voof2, d6voof3 automated match to d1maba3 complexed with adp, atp, ttx |
PDB Entry: 6voo (more details), 3.05 Å
SCOPe Domain Sequences for d6voob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6voob2 c.37.1.0 (B:96-372) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} aqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaid amipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqe rgameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqms lllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnv isitdgqiflsadlfnagirpainvgisvsrvgsaaq
Timeline for d6voob2: