Lineage for d6voob2 (6voo B:96-372)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872841Species Spinach (Spinacia oleracea) [TaxId:3562] [352453] (2 PDB entries)
  8. 2872843Domain d6voob2: 6voo B:96-372 [392766]
    Other proteins in same PDB: d6vooa1, d6vooa3, d6voob1, d6voob3, d6vooc1, d6vooc3, d6vood1, d6vood2, d6vood3, d6vooe1, d6vooe2, d6vooe3, d6voof1, d6voof2, d6voof3
    automated match to d1maba3
    complexed with adp, atp, ttx

Details for d6voob2

PDB Entry: 6voo (more details), 3.05 Å

PDB Description: chloroplast atp synthase (r1, cf1)
PDB Compounds: (B:) ATP synthase subunit alpha, chloroplastic

SCOPe Domain Sequences for d6voob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6voob2 c.37.1.0 (B:96-372) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
aqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaid
amipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqe
rgameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqms
lllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnv
isitdgqiflsadlfnagirpainvgisvsrvgsaaq

SCOPe Domain Coordinates for d6voob2:

Click to download the PDB-style file with coordinates for d6voob2.
(The format of our PDB-style files is described here.)

Timeline for d6voob2: