Lineage for d1rcxb2 (1rcx B:9-147)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257593Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 257594Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 257595Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 257644Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 257674Domain d1rcxb2: 1rcx B:9-147 [39271]
    Other proteins in same PDB: d1rcxb1, d1rcxc_, d1rcxe1, d1rcxf_, d1rcxh1, d1rcxi_, d1rcxk1, d1rcxl1, d1rcxm_, d1rcxo1, d1rcxp_, d1rcxr1, d1rcxs_, d1rcxt_, d1rcxv1, d1rcxw_

Details for d1rcxb2

PDB Entry: 1rcx (more details), 2.4 Å

PDB Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate

SCOP Domain Sequences for d1rcxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcxb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcxb2:

Click to download the PDB-style file with coordinates for d1rcxb2.
(The format of our PDB-style files is described here.)

Timeline for d1rcxb2: