Lineage for d1rcoe2 (1rco E:9-147)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133756Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 133757Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 133758Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 133791Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 133814Domain d1rcoe2: 1rco E:9-147 [39264]
    Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_

Details for d1rcoe2

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcoe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rcoe2:

Click to download the PDB-style file with coordinates for d1rcoe2.
(The format of our PDB-style files is described here.)

Timeline for d1rcoe2: