Lineage for d1rxob2 (1rxo B:9-147)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205860Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1205861Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1205862Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1206006Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 1206023Domain d1rxob2: 1rxo B:9-147 [39258]
    Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_
    complexed with ca, rub

Details for d1rxob2

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
PDB Compounds: (B:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rxob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxob2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d1rxob2:

Click to download the PDB-style file with coordinates for d1rxob2.
(The format of our PDB-style files is described here.)

Timeline for d1rxob2: