SCOPe 2.03: Domain d1rxol2: 1rxo L:9-147

Lineage for d1rxol2 (1rxo L:9-147)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (10 PDB entries)

8. Domain d1rxol2: 1rxo L:9-147 [39257]
   Other proteins in same PDB: d1rxob1, d1rxoc_, d1rxoe1, d1rxof_, d1rxoh1, d1rxoi_, d1rxol1, d1rxos_
   complexed with ca, rub

Details for d1rxol2

PDB Entry: 1rxo, 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

PDB Compounds: (L:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rxol2:

Sequence; same for both SEQRES and ATOM records:

>d1rxol2 d.58.9.1 (L:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d1rxol2:

• d1rxol2 first appeared (with stable ids) in SCOP 1.55
  
• d1rxol2 appears in SCOPe 2.02
  
• d1rxol2 appears in SCOPe 2.04
  
• d1rxol2 appears in the current release, SCOPe 2.08