SCOPe 2.06: Domain d1aa1h2: 1aa1 H:21-147

Lineage for d1aa1h2 (1aa1 H:21-147)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
C-terminal domain is beta/alpha barrel
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
Domain d1aa1h2: 1aa1 H:21-147 [39256]
Other proteins in same PDB: d1aa1b1, d1aa1c_, d1aa1e1, d1aa1f_, d1aa1h1, d1aa1i_, d1aa1l1, d1aa1s_
complexed with 3pg, mg

Details for d1aa1h2

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

PDB Compounds: (H:) ribulose bisphosphate carboxylase (large chain)

SCOPe Domain Sequences for d1aa1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1h2 d.58.9.1 (H:21-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
pvayvkt

SCOPe Domain Coordinates for d1aa1h2:

Click to download the PDB-style file with coordinates for d1aa1h2.
(The format of our PDB-style files is described here.)

Timeline for d1aa1h2: