Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
Domain d1aa1e2: 1aa1 E:21-147 [39255] Other proteins in same PDB: d1aa1b1, d1aa1c_, d1aa1e1, d1aa1f_, d1aa1h1, d1aa1i_, d1aa1l1, d1aa1s_ complexed with 3pg, mg |
PDB Entry: 1aa1 (more details), 2.2 Å
SCOPe Domain Sequences for d1aa1e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa1e2 d.58.9.1 (E:21-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri pvayvkt
Timeline for d1aa1e2: