SCOP 1.71: Domain d1aa1b2: 1aa1 B:21-147

Lineage for d1aa1b2 (1aa1 B:21-147)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (10 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

8. Domain d1aa1b2: 1aa1 B:21-147 [39254]
   Other proteins in same PDB: d1aa1b1, d1aa1c_, d1aa1e1, d1aa1f_, d1aa1h1, d1aa1i_, d1aa1l1, d1aa1s_

Details for d1aa1b2

PDB Entry: 1aa1, 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1b2:

Sequence; same for both SEQRES and ATOM records:

>d1aa1b2 d.58.9.1 (B:21-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
kltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldry
kgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlri
pvayvkt

Timeline for d1aa1b2:

• d1aa1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1aa1b2 appears in SCOP 1.69
  
• d1aa1b2 appears in SCOP 1.73
  
• d1aa1b2 appears in the current release, SCOPe 2.08