SCOPe 2.07: Domain d6utjq1: 6utj Q:4-223

Lineage for d6utjq1 (6utj Q:4-223)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.8: Proteasome activator [47216] (1 family)

5. Family a.24.8.1: Proteasome activator [47217] (3 proteins)

6. Protein automated matches [190828] (1 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)

8. Domain d6utjq1: 6utj Q:4-223 [392532]
   Other proteins in same PDB: d6utj1_, d6utj2_, d6utja_, d6utjb_, d6utjc_, d6utjd_, d6utje_, d6utjf_, d6utjg_, d6utjh_, d6utji_, d6utjj_, d6utjk_, d6utjl_, d6utjm_, d6utjn_, d6utjo2, d6utjp2, d6utjq2, d6utjr2, d6utjs2, d6utjt2, d6utju2, d6utjv_, d6utjw_, d6utjx_, d6utjy_, d6utjz_
   automated match to d3jrmo_

Details for d6utjq1

PDB Entry: 6utj, 2.9 Å

PDB Description: allosteric couple between alpha rings of the 20s proteasome. 20s proteasome singly capped by pa26/e102a, c-terminus replaced by pan c- terminus

PDB Compounds: (Q:) proteasome activator protein PA26

SCOPe Domain Sequences for d6utjq1:

Sequence, based on SEQRES records:

>d6utjq1 a.24.8.1 (Q:4-223) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaveahgtirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkvideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqpr

Sequence, based on observed residues (ATOM records):

>d6utjq1 a.24.8.1 (Q:4-223) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaveahgtirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkvideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqpr

Timeline for d6utjq1:

• d6utjq1 is new in SCOPe 2.07-stable