Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6v4ob1: 6v4o B:1-106 [392528] Other proteins in same PDB: d6v4oa_, d6v4ob2, d6v4oc_, d6v4od_, d6v4oe2, d6v4og2, d6v4oh_, d6v4oi1, d6v4oi2, d6v4ol2, d6v4om1, d6v4om2, d6v4on1, d6v4on2, d6v4ow1, d6v4ow2 automated match to d1dn0a1 complexed with bma, ca |
PDB Entry: 6v4o (more details), 2.8 Å
SCOPe Domain Sequences for d6v4ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v4ob1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslfpgeratlscrasqsagskslawyqhkvgqpprllingassratgip drfsgsgsgpdfnltisrlepedfavyycqrygtslvtfgggtkvei
Timeline for d6v4ob1: