Lineage for d6v4ob1 (6v4o B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743285Domain d6v4ob1: 6v4o B:1-106 [392528]
    Other proteins in same PDB: d6v4oa_, d6v4ob2, d6v4oc_, d6v4od_, d6v4oe2, d6v4og2, d6v4oh_, d6v4oi1, d6v4oi2, d6v4ol2, d6v4om1, d6v4om2, d6v4on1, d6v4on2, d6v4ow1, d6v4ow2
    automated match to d1dn0a1
    complexed with bma, ca

Details for d6v4ob1

PDB Entry: 6v4o (more details), 2.8 Å

PDB Description: structure of human 2e01 fab in complex with influenza virus neuraminidase from b/phuket/3073/2013
PDB Compounds: (B:) antibody fab light chain

SCOPe Domain Sequences for d6v4ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v4ob1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslfpgeratlscrasqsagskslawyqhkvgqpprllingassratgip
drfsgsgsgpdfnltisrlepedfavyycqrygtslvtfgggtkvei

SCOPe Domain Coordinates for d6v4ob1:

Click to download the PDB-style file with coordinates for d6v4ob1.
(The format of our PDB-style files is described here.)

Timeline for d6v4ob1: