SCOPe 2.04: Domain d1rboe2: 1rbo E:9-147

Lineage for d1rboe2 (1rbo E:9-147)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (10 PDB entries)

8. Domain d1rboe2: 1rbo E:9-147 [39251]
   Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_
   complexed with cap

Details for d1rboe2

PDB Entry: 1rbo, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

PDB Compounds: (E:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rboe2:

Sequence; same for both SEQRES and ATOM records:

>d1rboe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d1rboe2:

• d1rboe2 first appeared (with stable ids) in SCOP 1.55
  
• d1rboe2 appears in SCOPe 2.03
  
• d1rboe2 appears in SCOPe 2.05
  
• d1rboe2 appears in the current release, SCOPe 2.08