Lineage for d6utjg_ (6utj G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (14 species)
    not a true protein
  7. 2554678Species Thermoplasma acidophilum [TaxId:2303] [186869] (8 PDB entries)
  8. 3092443Domain d6utjg_: 6utj G: [392505]
    Other proteins in same PDB: d6utj1_, d6utj2_, d6utjh_, d6utji_, d6utjj_, d6utjk_, d6utjl_, d6utjm_, d6utjn_, d6utjo1, d6utjo2, d6utjp1, d6utjp2, d6utjq1, d6utjq2, d6utjr1, d6utjr2, d6utjs1, d6utjs2, d6utjt1, d6utjt2, d6utju1, d6utju2, d6utjv_, d6utjw_, d6utjx_, d6utjy_, d6utjz_
    automated match to d1ya7a_

Details for d6utjg_

PDB Entry: 6utj (more details), 2.9 Å

PDB Description: allosteric couple between alpha rings of the 20s proteasome. 20s proteasome singly capped by pa26/e102a, c-terminus replaced by pan c- terminus
PDB Compounds: (G:) Proteasome subunit alpha

SCOPe Domain Sequences for d6utjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6utjg_ d.153.1.4 (G:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d6utjg_:

Click to download the PDB-style file with coordinates for d6utjg_.
(The format of our PDB-style files is described here.)

Timeline for d6utjg_:

  • d6utjg_ is new in SCOPe 2.07-stable