Lineage for d1rbob2 (1rbo B:9-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32786Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 32795Domain d1rbob2: 1rbo B:9-147 [39250]
    Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_

Details for d1rbob2

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rbob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbob2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rbob2:

Click to download the PDB-style file with coordinates for d1rbob2.
(The format of our PDB-style files is described here.)

Timeline for d1rbob2: