Lineage for d6urim_ (6uri M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970862Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2970875Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins)
    automatically mapped to Pfam PF01217
  6. 2970892Protein automated matches [373811] (2 species)
    not a true protein
  7. 2970893Species Human (Homo sapiens) [TaxId:9606] [392494] (1 PDB entry)
  8. 2970894Domain d6urim_: 6uri M: [392495]
    Other proteins in same PDB: d6uria_, d6urib_, d6uris_
    automated match to d2vglm1

Details for d6urim_

PDB Entry: 6uri (more details), 3 Å

PDB Description: hiv-1 nef in complex with the cd4 cytoplasmic domain and the ap2 clathrin adaptor complex
PDB Compounds: (M:) ap-2 complex subunit mu

SCOPe Domain Sequences for d6urim_:

Sequence, based on SEQRES records: (download)

>d6urim_ d.110.4.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqns

Sequence, based on observed residues (ATOM records): (download)

>d6urim_ d.110.4.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
migglfiynhkgevlisrvyrddigrnavdafrvnvihvrspvtniartsffhvkrsniw
laavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgypqns

SCOPe Domain Coordinates for d6urim_:

Click to download the PDB-style file with coordinates for d6urim_.
(The format of our PDB-style files is described here.)

Timeline for d6urim_: