Lineage for d8rucg2 (8ruc G:9-147)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909193Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1909194Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1909288Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (10 PDB entries)
  8. 1909292Domain d8rucg2: 8ruc G:9-147 [39248]
    Other proteins in same PDB: d8ruca1, d8rucc1, d8ruce1, d8rucg1, d8ruci_, d8rucj_, d8ruck_, d8rucl_
    complexed with cap, mg

Details for d8rucg2

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (G:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d8rucg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8rucg2 d.58.9.1 (G:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d8rucg2:

Click to download the PDB-style file with coordinates for d8rucg2.
(The format of our PDB-style files is described here.)

Timeline for d8rucg2: