Lineage for d8rucg2 (8ruc G:9-147)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80425Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 80426Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 80427Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 80449Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 80457Domain d8rucg2: 8ruc G:9-147 [39248]
    Other proteins in same PDB: d8ruca1, d8rucc1, d8ruce1, d8rucg1, d8ruci_, d8rucj_, d8ruck_, d8rucl_

Details for d8rucg2

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

SCOP Domain Sequences for d8rucg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8rucg2 d.58.9.1 (G:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d8rucg2:

Click to download the PDB-style file with coordinates for d8rucg2.
(The format of our PDB-style files is described here.)

Timeline for d8rucg2: