Lineage for d1burb2 (1bur B:12-147)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133756Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 133757Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 133758Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 133791Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 133793Domain d1burb2: 1bur B:12-147 [39242]
    Other proteins in same PDB: d1bura1, d1burb1, d1burc1, d1burd1, d1burs_, d1burt_, d1buru_, d1burv_

Details for d1burb2

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1burb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1burb2 d.58.9.1 (B:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripvayvkt

SCOP Domain Coordinates for d1burb2:

Click to download the PDB-style file with coordinates for d1burb2.
(The format of our PDB-style files is described here.)

Timeline for d1burb2: