Lineage for d1bura2 (1bur A:12-147)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80425Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 80426Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 80427Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 80449Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 80450Domain d1bura2: 1bur A:12-147 [39241]
    Other proteins in same PDB: d1bura1, d1burb1, d1burc1, d1burd1, d1burs_, d1burt_, d1buru_, d1burv_

Details for d1bura2

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1bura2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bura2 d.58.9.1 (A:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt
dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripvayvkt

SCOP Domain Coordinates for d1bura2:

Click to download the PDB-style file with coordinates for d1bura2.
(The format of our PDB-style files is described here.)

Timeline for d1bura2: