SCOPe 2.08: Domain d6uraa1: 6ura A:23-151

Lineage for d6uraa1 (6ura A:23-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Candidatus promineofilum [TaxId:1806508] [392407] (1 PDB entry)

8. Domain d6uraa1: 6ura A:23-151 [392408]
   Other proteins in same PDB: d6uraa2, d6urab2, d6urac2, d6urad2
   automated match to d4ruba2
   complexed with cap, mg

Details for d6uraa1

PDB Entry: 6ura, 2.17 Å

PDB Description: crystal structure of rubisco from promineofilum breve

PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6uraa1:

Sequence; same for both SEQRES and ATOM records:

>d6uraa1 d.58.9.0 (A:23-151) automated matches {Candidatus promineofilum [TaxId: 1806508]}
daykagvrayavdyyvpdyipqdtdllcafriqprgvdmieaaaavaaesstgtwtevws
nqltdidfykakvyaitgdiayiaypldlfeensvvnimssivgnvfgfkavgalrledm
riplalvkt

Timeline for d6uraa1:

• d6uraa1 first appeared in SCOPe 2.07