Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species) |
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries) |
Domain d4rubc2: 4rub C:9-147 [39239] Other proteins in same PDB: d4ruba1, d4rubb1, d4rubc1, d4rubd1, d4rubs_, d4rubt_, d4rubu_, d4rubv_ |
PDB Entry: 4rub (more details), 2.7 Å
SCOP Domain Sequences for d4rubc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rubc2 d.58.9.1 (C:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun} asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk alralrledlrippayvkt
Timeline for d4rubc2: