Lineage for d1ej7l2 (1ej7 L:18-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724922Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 724924Domain d1ej7l2: 1ej7 L:18-147 [39233]
    Other proteins in same PDB: d1ej7l1, d1ej7s_
    complexed with po4

Details for d1ej7l2

PDB Entry: 1ej7 (more details), 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions
PDB Compounds: (L:) rubisco (large subunit)

SCOP Domain Sequences for d1ej7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej7l2 d.58.9.1 (L:18-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl
drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled
lrippayvkt

SCOP Domain Coordinates for d1ej7l2:

Click to download the PDB-style file with coordinates for d1ej7l2.
(The format of our PDB-style files is described here.)

Timeline for d1ej7l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ej7l1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ej7s_