Lineage for d1ej7l2 (1ej7 L:18-147)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133756Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 133757Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 133758Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 133832Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 133834Domain d1ej7l2: 1ej7 L:18-147 [39233]
    Other proteins in same PDB: d1ej7l1, d1ej7s_

Details for d1ej7l2

PDB Entry: 1ej7 (more details), 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions

SCOP Domain Sequences for d1ej7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej7l2 d.58.9.1 (L:18-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl
drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled
lrippayvkt

SCOP Domain Coordinates for d1ej7l2:

Click to download the PDB-style file with coordinates for d1ej7l2.
(The format of our PDB-style files is described here.)

Timeline for d1ej7l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ej7l1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ej7s_