Lineage for d3rubl2 (3rub L:22-147)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192424Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 192425Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 192426Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 192516Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [54969] (5 PDB entries)
  8. 192517Domain d3rubl2: 3rub L:22-147 [39232]
    Other proteins in same PDB: d3rubl1, d3rubs_

Details for d3rubl2

PDB Entry: 3rub (more details), 2 Å

PDB Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution

SCOP Domain Sequences for d3rubl2:

Sequence, based on SEQRES records: (download)

>d3rubl2 d.58.9.1 (L:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
payvkt

Sequence, based on observed residues (ATOM records): (download)

>d3rubl2 d.58.9.1 (L:22-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
t

SCOP Domain Coordinates for d3rubl2:

Click to download the PDB-style file with coordinates for d3rubl2.
(The format of our PDB-style files is described here.)

Timeline for d3rubl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rubl1
View in 3D
Domains from other chains:
(mouse over for more information)
d3rubs_