Lineage for d6ucda2 (6ucd A:95-196)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934588Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)
  8. 2934604Domain d6ucda2: 6ucd A:95-196 [392284]
    Other proteins in same PDB: d6ucda1
    automated match to d3r2ta2

Details for d6ucda2

PDB Entry: 6ucd (more details), 2.85 Å

PDB Description: the crystal structure of staphylococcus aureus super antigen-like protein ssl10
PDB Compounds: (A:) Exotoxin

SCOPe Domain Sequences for d6ucda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ucda2 d.15.6.0 (A:95-196) automated matches {Staphylococcus aureus [TaxId: 1280]}
tsgvvsapilniskekgedafvkgypyyikkekitlkeldyklrkhliekyglyktiskd
grvkislkdgsfynldlrsklkfkymgevieskqikdievnl

SCOPe Domain Coordinates for d6ucda2:

Click to download the PDB-style file with coordinates for d6ucda2.
(The format of our PDB-style files is described here.)

Timeline for d6ucda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ucda1
View in 3D
Domains from other chains:
(mouse over for more information)
d6ucdb1