SCOPe 2.08: Domain d1f9fb1: 1f9f B:287-365

Lineage for d1f9fb1 (1f9f B:287-365)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)

8. Domain d1f9fb1: 1f9f B:287-365 [39225]
   Other proteins in same PDB: d1f9fa2, d1f9fb2, d1f9fc2, d1f9fd2
   complexed with so4

Details for d1f9fb1

PDB Entry: 1f9f, 1.9 Å

PDB Description: crystal structure of the hpv-18 e2 dna-binding domain

PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1f9fb1:

Sequence, based on SEQRES records:

>d1f9fb1 d.58.8.1 (B:287-365) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtkf
lntvaipdsvqilvgymtm

Sequence, based on observed residues (ATOM records):

>d1f9fb1 d.58.8.1 (B:287-365) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtktgiltvtyhsetqrtkflntva
ipdsvqilvgymtm

Timeline for d1f9fb1:

• d1f9fb1 first appeared (with stable ids) in SCOP 1.55, called d1f9fb_
  
• d1f9fb1 appears in SCOPe 2.07